Lineage for d1vk8c_ (1vk8 C:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 505679Superfamily d.58.48: MTH1187/YkoF-like [89957] (2 families) (S)
  5. 505680Family d.58.48.1: MTH1187-like [89958] (3 proteins)
    Pfam 01910; unknown function
    two domains form a single beta-sheet dimer; two dimers pack sheet-to-sheet in a tetramer; contains extra C-terminal helix
  6. 505687Protein Hypothetical protein TM0486 [110985] (1 species)
  7. 505688Species Thermotoga maritima [TaxId:243274] [110986] (1 PDB entry)
  8. 505691Domain d1vk8c_: 1vk8 C: [108638]

Details for d1vk8c_

PDB Entry: 1vk8 (more details), 1.8 Å

PDB Description: crystal structure of a putative thiamine biosynthesis/salvage protein (tm0486) from thermotoga maritima at 1.80 a resolution

SCOP Domain Sequences for d1vk8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vk8c_ d.58.48.1 (C:) Hypothetical protein TM0486 {Thermotoga maritima}
mpkvtvsikvvpavedgrlhevidraiekisswgmkyevgpsnttvegefeeimdrvkel
aryleqfakrfvlqldidykaggitieekvskyr

SCOP Domain Coordinates for d1vk8c_:

Click to download the PDB-style file with coordinates for d1vk8c_.
(The format of our PDB-style files is described here.)

Timeline for d1vk8c_: