SCOP 1.73: Domain d1vk8b_: 1vk8 B:

Lineage for d1vk8b_ (1vk8 B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.48: MTH1187/YkoF-like [89957] (2 families)

5. Family d.58.48.1: MTH1187-like [89958] (5 proteins)
   Pfam PF01910; two domains form a single beta-sheet dimer; two dimers pack sheet-to-sheet in a tetramer; contains extra C-terminal helix

6. Protein Hypothetical protein TM0486 [110985] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [110986] (1 PDB entry)

8. Domain d1vk8b_: 1vk8 B: [108637]

Details for d1vk8b_

PDB Entry: 1vk8, 1.8 Å

PDB Description: crystal structure of a putative thiamine biosynthesis/salvage protein (tm0486) from thermotoga maritima at 1.80 a resolution

PDB Compounds: (B:) hypothetical protein TM0486

SCOP Domain Sequences for d1vk8b_:

Sequence; same for both SEQRES and ATOM records:

>d1vk8b_ d.58.48.1 (B:) Hypothetical protein TM0486 {Thermotoga maritima [TaxId: 2336]}
pkvtvsikvvpavedgrlhevidraiekisswgmkyevgpsnttvegefeeimdrvkela
ryleqfakrfvlqldidykaggitieekvskyr

Timeline for d1vk8b_:

• d1vk8b_ first appeared in SCOP 1.69
  
• d1vk8b_ appears in SCOP 1.71
  
• d1vk8b_ appears in SCOP 1.75
  
• d1vk8b_ appears in the current release, SCOPe 2.08