Lineage for d1vk5a_ (1vk5 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 546251Fold a.220: Hypothetical protein At3g22680 [109919] (1 superfamily)
    5 helices; array; probable biological unit is a homodimer
  4. 546252Superfamily a.220.1: Hypothetical protein At3g22680 [109920] (1 family) (S)
  5. 546253Family a.220.1.1: Hypothetical protein At3g22680 [109921] (1 protein)
  6. 546254Protein Hypothetical protein At3g22680 [109922] (1 species)
  7. 546255Species Thale-cress (Arabidopsis thaliana) [TaxId:3702] [109923] (1 PDB entry)
  8. 546256Domain d1vk5a_: 1vk5 A: [108635]
    Structural genomics target
    complexed with cps, edo, so4

Details for d1vk5a_

PDB Entry: 1vk5 (more details), 1.6 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at3g22680

SCOP Domain Sequences for d1vk5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vk5a_ a.220.1.1 (A:) Hypothetical protein At3g22680 {Thale-cress (Arabidopsis thaliana)}
gsllrraemyqdymkqvpiptnrgslipftswvglsismkqlygqplhyltnvllqrwdq
srfgtdseeqrldsiihptkaeatiwlveeihrltpshlhmallwrsdpmyhsfidpifp
e

SCOP Domain Coordinates for d1vk5a_:

Click to download the PDB-style file with coordinates for d1vk5a_.
(The format of our PDB-style files is described here.)

Timeline for d1vk5a_: