Lineage for d1vk1a_ (1vk1 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009272Fold d.268: ParB/Sulfiredoxin [110848] (1 superfamily)
    beta*-alpha-beta(2)-alpha-beta-alpha; mixed beta sheet forms a partly open barrel: (n*=4, S*=8)
  4. 3009273Superfamily d.268.1: ParB/Sulfiredoxin [110849] (5 families) (S)
  5. 3009285Family d.268.1.2: Hypothetical protein PF0380 [110853] (2 proteins)
    contains insert domain (101-200) of an unusual alpha+beta fold beta-alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel beta-sheet, order 516342; possibly related to Pfam PF06245
  6. 3009286Protein Hypothetical protein PF0380 [110854] (1 species)
  7. 3009287Species Pyrococcus furiosus [TaxId:2261] [110855] (1 PDB entry)
    Uniprot Q8U3S5
  8. 3009288Domain d1vk1a_: 1vk1 A: [108634]
    complexed with na, peg, po4

Details for d1vk1a_

PDB Entry: 1vk1 (more details), 1.2 Å

PDB Description: conserved hypothetical protein from pyrococcus furiosus pfu-392566-001
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1vk1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vk1a_ d.268.1.2 (A:) Hypothetical protein PF0380 {Pyrococcus furiosus [TaxId: 2261]}
ipvkkveyvfieldkmkpheqlvqreledfiesvtgsgifwkpmllakipgtdeylivdg
hhrwaglqklgakrapsvildyfdegvkvytwypafkgdvnkvierlkaegleviedeka
eekaekgeiafaligeksfaipggleeqkkvskvldemdqakeielvyyglkedakadme
kgeidyvfirkaptkeevmelvkrgevfspkttrhvlpfipdkidvkledlf

SCOPe Domain Coordinates for d1vk1a_:

Click to download the PDB-style file with coordinates for d1vk1a_.
(The format of our PDB-style files is described here.)

Timeline for d1vk1a_: