Lineage for d1vjka_ (1vjk A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499486Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 499737Superfamily d.15.3: MoaD/ThiS [54285] (2 families) (S)
    possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies
  5. 499738Family d.15.3.1: MoaD [54286] (2 proteins)
  6. 499745Protein Molybdopterin synthase subunit MoaD [54287] (2 species)
  7. 499753Species Pyrococcus furiosus [TaxId:186497] [110806] (1 PDB entry)
  8. 499754Domain d1vjka_: 1vjk A: [108631]
    Structural genomics target

Details for d1vjka_

PDB Entry: 1vjk (more details), 1.51 Å

PDB Description: putative molybdopterin converting factor, subunit 1 from pyrococcus furiosus, pfu-562899-001

SCOP Domain Sequences for d1vjka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vjka_ d.15.3.1 (A:) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus}
svkvkvkyfarfrqlagvdeeeielpegarvrdlieeikkrhekfkeevfgegydedadv
niavngryvswdeelkdgdvvgvfppvs

SCOP Domain Coordinates for d1vjka_:

Click to download the PDB-style file with coordinates for d1vjka_.
(The format of our PDB-style files is described here.)

Timeline for d1vjka_: