SCOPe 2.08: Domain d1vjka1: 1vjk A:2-88

Lineage for d1vjka1 (1vjk A:2-88)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.3: MoaD/ThiS [54285] (5 families)
   possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies

5. Family d.15.3.1: MoaD [54286] (2 proteins)
   automatically mapped to Pfam PF02597

6. Protein Molybdopterin synthase subunit MoaD [54287] (2 species)

7. Species Pyrococcus furiosus [TaxId:2261] [110806] (1 PDB entry)
   Uniprot Q8U3C7

8. Domain d1vjka1: 1vjk A:2-88 [108631]
   Other proteins in same PDB: d1vjka2
   Structural genomics target

Details for d1vjka1

PDB Entry: 1vjk, 1.51 Å

PDB Description: putative molybdopterin converting factor, subunit 1 from pyrococcus furiosus, pfu-562899-001

PDB Compounds: (A:) molybdopterin converting factor, subunit 1

SCOPe Domain Sequences for d1vjka1:

Sequence; same for both SEQRES and ATOM records:

>d1vjka1 d.15.3.1 (A:2-88) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]}
vkvkvkyfarfrqlagvdeeeielpegarvrdlieeikkrhekfkeevfgegydedadvn
iavngryvswdeelkdgdvvgvfppvs

Timeline for d1vjka1:

• d1vjka1 first appeared in SCOP 1.69, called d1vjka_
  
• d1vjka1 appears in SCOPe 2.07