Lineage for d1vjba_ (1vjb A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. Protein Orphan nuclear receptor ERR3 [81916] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [81917] (24 PDB entries)
    Uniprot O75454 233-458
  8. Domain d1vjba_: 1vjb A: [108629]
    complexed with oht

Details for d1vjba_

PDB Entry: 1vjb (more details), 3.2 Å

PDB Description: crystal structure of the ligand-binding domain of the estrogen-related receptor gamma in complex with 4-hydroxytamoxifen
PDB Compounds: (A:) Estrogen-related receptor gamma

SCOPe Domain Sequences for d1vjba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vjba_ a.123.1.1 (A:) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]}
ynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstls
ladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailqlv
kkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedprr
agkmlmtlpllrqtstkavqhfynikle

SCOPe Domain Coordinates for d1vjba_ are not available.

Timeline for d1vjba_:

Domains from other chains:
(mouse over for more information)
d1vjbb_