Lineage for d1vjau_ (1vja U:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2406247Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)
  7. 2406248Species Human (Homo sapiens) [TaxId:9606] [50587] (88 PDB entries)
    Uniprot P00749 156-178,179-424
  8. 2406280Domain d1vjau_: 1vja U: [108628]
    complexed with 7in, so4

Details for d1vjau_

PDB Entry: 1vja (more details), 2 Å

PDB Description: urokinase plasminogen activator b-chain-jt463 complex
PDB Compounds: (U:) Plasminogen activator, urokinase

SCOPe Domain Sequences for d1vjau_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vjau_ b.47.1.2 (U:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
slpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irshtke

SCOPe Domain Coordinates for d1vjau_:

Click to download the PDB-style file with coordinates for d1vjau_.
(The format of our PDB-style files is described here.)

Timeline for d1vjau_: