Class b: All beta proteins [48724] (144 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins) |
Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50587] (35 PDB entries) |
Domain d1vjau_: 1vja U: [108628] |
PDB Entry: 1vja (more details), 2 Å
SCOP Domain Sequences for d1vjau_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vjau_ b.47.1.2 (U:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens)} iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti slpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw irshtke
Timeline for d1vjau_: