Lineage for d1vgrb_ (1vgr B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 496413Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
    consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit
  4. 496414Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (1 family) (S)
  5. 496415Family c.123.1.1: CoA-transferase family III (CaiB/BaiF) [89797] (2 proteins)
    forms interlocked homodimer of two ring-like subunits
  6. 496416Protein Formyl-CoA transferase [89798] (1 species)
  7. 496417Species Oxalobacter formigenes [TaxId:847] [89799] (6 PDB entries)
  8. 496423Domain d1vgrb_: 1vgr B: [108626]

Details for d1vgrb_

PDB Entry: 1vgr (more details), 2.1 Å

PDB Description: Formyl-CoA transferase mutant Asp169 to Glu

SCOP Domain Sequences for d1vgrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vgrb_ c.123.1.1 (B:) Formyl-CoA transferase {Oxalobacter formigenes}
tkpldginvldfthvqagpactqmmgflganvikierrgsgdmtrgwlqdkpnvdslyft
mfncnkrsieldmktpegkelleqmikkadvmvenfgpgaldrmgftweyiqelnprvil
asvkgyaeghanehlkvyenvaqcsggaaattgfwdgpptvsgaalgesnsgmhlmigil
aaleirhktgrgqkvavamqdavlnlvriklrdqqrlertgilaeypqaqpnfafdrdgn
plsfdnitsvprggnaggggqpgwmlkckgwetdadsyvyftiaanmwpqicdmidkpew
kddpayntfegrvdklmdifsfietkfadkdkfevtewaaqygipcgpvmsmkelahdps
lqkvgtvvevvdeirgnhltvgapfkfsgfqpeitrapllgehtdevlkelglddakike
lhakqvv

SCOP Domain Coordinates for d1vgrb_:

Click to download the PDB-style file with coordinates for d1vgrb_.
(The format of our PDB-style files is described here.)

Timeline for d1vgrb_: