Lineage for d1vg9c2 (1vg9 C:445-557)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 500350Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 500351Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 500584Family d.16.1.6: GDI-like [54399] (2 proteins)
    Similar to FAD-linked reductases in both domains but does not bind FAD
  6. 500592Protein Rab escort protein 1 [89845] (1 species)
  7. 500593Species Rat (Rattus norvegicus) [TaxId:10116] [89846] (3 PDB entries)
  8. 500596Domain d1vg9c2: 1vg9 C:445-557 [108614]
    Other proteins in same PDB: d1vg9a1, d1vg9b_, d1vg9c1, d1vg9d_, d1vg9e1, d1vg9f_, d1vg9g1, d1vg9h_

Details for d1vg9c2

PDB Entry: 1vg9 (more details), 2.5 Å

PDB Description: the crystal structures of the rep-1 protein in complex with c- terminally truncated rab7 protein

SCOP Domain Sequences for d1vg9c2:

Sequence, based on SEQRES records: (download)

>d1vg9c2 d.16.1.6 (C:445-557) Rab escort protein 1 {Rat (Rattus norvegicus)}
qyrqisravlitdgsvlrtdadqqvsiltvpaeepgsfavrvielcsstmtcmkgtylvh
ltcmssktaredlervvqklftpyteieaeneqvekprllwalyfnmrdssdi

Sequence, based on observed residues (ATOM records): (download)

>d1vg9c2 d.16.1.6 (C:445-557) Rab escort protein 1 {Rat (Rattus norvegicus)}
qyrqisravlitdgsvlrtdadqqvsiltvpaeepgsfavrvielcsstmtcmkgtylvh
ltcmssktaredlervvqklftpyteekprllwalyfnmrdssdi

SCOP Domain Coordinates for d1vg9c2:

Click to download the PDB-style file with coordinates for d1vg9c2.
(The format of our PDB-style files is described here.)

Timeline for d1vg9c2: