![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
![]() | Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) ![]() N-terminal domain is beta/beta/alpha common fold |
![]() | Family d.16.1.6: GDI-like [54399] (2 proteins) Similar to FAD-linked reductases in both domains but does not bind FAD |
![]() | Protein Rab escort protein 1 [89845] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [89846] (3 PDB entries) Uniprot P37727 |
![]() | Domain d1vg9c2: 1vg9 C:445-557 [108614] Other proteins in same PDB: d1vg9a1, d1vg9b_, d1vg9c1, d1vg9d_, d1vg9e1, d1vg9f_, d1vg9g1, d1vg9h_ complexed with gdp, k, mg, p33 |
PDB Entry: 1vg9 (more details), 2.5 Å
SCOPe Domain Sequences for d1vg9c2:
Sequence, based on SEQRES records: (download)
>d1vg9c2 d.16.1.6 (C:445-557) Rab escort protein 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]} qyrqisravlitdgsvlrtdadqqvsiltvpaeepgsfavrvielcsstmtcmkgtylvh ltcmssktaredlervvqklftpyteieaeneqvekprllwalyfnmrdssdi
>d1vg9c2 d.16.1.6 (C:445-557) Rab escort protein 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]} qyrqisravlitdgsvlrtdadqqvsiltvpaeepgsfavrvielcsstmtcmkgtylvh ltcmssktaredlervvqklftpyteekprllwalyfnmrdssdi
Timeline for d1vg9c2: