SCOPe 2.05: Domain d1vg8d_: 1vg8 D:

Lineage for d1vg8d_ (1vg8 D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab7 [110540] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [110541] (4 PDB entries)
   Uniprot P09527

8. Domain d1vg8d_: 1vg8 D: [108609]
   complexed with gnp, mg

Details for d1vg8d_

PDB Entry: 1vg8, 1.7 Å

PDB Description: gppnhp-bound rab7

PDB Compounds: (D:) Ras-related protein Rab-7

SCOPe Domain Sequences for d1vg8d_:

Sequence; same for both SEQRES and ATOM records:

>d1vg8d_ c.37.1.8 (D:) Rab7 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdtag
qerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgnk
idlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevelynef
pepi

Timeline for d1vg8d_:

• d1vg8d_ first appeared in SCOP 1.69
  
• d1vg8d_ appears in SCOPe 2.04
  
• d1vg8d_ appears in SCOPe 2.06
  
• d1vg8d_ appears in the current release, SCOPe 2.08