Lineage for d1vg8d_ (1vg8 D:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 484126Family c.37.1.8: G proteins [52592] (43 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 484431Protein Rab7 [110540] (1 species)
  7. 484432Species Rat (Rattus norvegicus) [TaxId:10116] [110541] (4 PDB entries)
  8. 484436Domain d1vg8d_: 1vg8 D: [108609]

Details for d1vg8d_

PDB Entry: 1vg8 (more details), 1.7 Å

PDB Description: gppnhp-bound rab7

SCOP Domain Sequences for d1vg8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vg8d_ c.37.1.8 (D:) Rab7 {Rat (Rattus norvegicus)}
vllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdtag
qerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgnk
idlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevelynef
pepi

SCOP Domain Coordinates for d1vg8d_:

Click to download the PDB-style file with coordinates for d1vg8d_.
(The format of our PDB-style files is described here.)

Timeline for d1vg8d_: