Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (43 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rab7 [110540] (1 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [110541] (4 PDB entries) |
Domain d1vg8a_: 1vg8 A: [108606] |
PDB Entry: 1vg8 (more details), 1.7 Å
SCOP Domain Sequences for d1vg8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus)} vllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdtag qerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgnk idlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevelynef pepi
Timeline for d1vg8a_: