Lineage for d1vg6a_ (1vg6 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 448631Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 448632Superfamily a.128.1: Terpenoid synthases [48576] (5 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 448633Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (2 proteins)
  6. 448649Protein Octoprenyl-diphosphate synthase [101455] (1 species)
  7. 448650Species Thermotoga maritima [TaxId:243274] [101456] (10 PDB entries)
  8. 448660Domain d1vg6a_: 1vg6 A: [108604]

Details for d1vg6a_

PDB Entry: 1vg6 (more details), 3.35 Å

PDB Description: crystal structure of octaprenyl pyrophosphate synthase from hyperthermophilic thermotoga maritima f132a/l128a/i123a mutant

SCOP Domain Sequences for d1vg6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vg6a_ a.128.1.1 (A:) Octoprenyl-diphosphate synthase {Thermotoga maritima}
nsyelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveigedaissla
alelvhlasllhddvidgarfrrgketinfmygdkaavaagdlvlvsafhtveeagnnka
rraalnvigkmseaelieqlsrykpitkeeylrivegksgalfglalqlpallegelged
lynlgvtigtiyqmfddimdfagmekigkdgfldlkngvasfplvtamekfpearqmfen
rdwsglmsfmrekgilkeceetlkvlvknviienswlrd

SCOP Domain Coordinates for d1vg6a_:

Click to download the PDB-style file with coordinates for d1vg6a_.
(The format of our PDB-style files is described here.)

Timeline for d1vg6a_: