SCOPe 2.07: Domain d1vg4b_: 1vg4 B:

Lineage for d1vg4b_ (1vg4 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)

6. Protein Octoprenyl-diphosphate synthase [101455] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [101456] (10 PDB entries)
   Uniprot Q9X1M1

8. Domain d1vg4b_: 1vg4 B: [108603]
   mutant

Details for d1vg4b_

PDB Entry: 1vg4, 3.3 Å

PDB Description: crystal structure of octaprenyl pyrophosphate synthase from hyperthermophilic thermotoga maritima f132a/l128a mutant

PDB Compounds: (B:) octoprenyl-diphosphate synthase

SCOPe Domain Sequences for d1vg4b_:

Sequence; same for both SEQRES and ATOM records:

>d1vg4b_ a.128.1.1 (B:) Octoprenyl-diphosphate synthase {Thermotoga maritima [TaxId: 2336]}
nsyelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveigedaissla
alelvhlasllhddvidgarfrrgketinfmygdkaavaagdlvlvsafhtveeignnka
rraalnvigkmseaelieqlsrykpitkeeylrivegksgalfglalqlpallegelged
lynlgvtigtiyqmfddimdfagmekigkdgfldlkngvasfplvtamekfpearqmfen
rdwsglmsfmrekgilkeceetlkvlvknviienswlrdf

Timeline for d1vg4b_:

• d1vg4b_ first appeared in SCOP 1.69
  
• d1vg4b_ appears in SCOPe 2.06
  
• d1vg4b_ appears in the current release, SCOPe 2.08