Lineage for d1vg4b_ (1vg4 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010549Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 protein domains)
  6. 2010579Protein Octoprenyl-diphosphate synthase [101455] (1 species)
  7. 2010580Species Thermotoga maritima [TaxId:2336] [101456] (10 PDB entries)
    Uniprot Q9X1M1
  8. 2010593Domain d1vg4b_: 1vg4 B: [108603]
    mutant

Details for d1vg4b_

PDB Entry: 1vg4 (more details), 3.3 Å

PDB Description: Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima F132A/L128A mutant
PDB Compounds: (B:) octoprenyl-diphosphate synthase

SCOPe Domain Sequences for d1vg4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vg4b_ a.128.1.1 (B:) Octoprenyl-diphosphate synthase {Thermotoga maritima [TaxId: 2336]}
nsyelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveigedaissla
alelvhlasllhddvidgarfrrgketinfmygdkaavaagdlvlvsafhtveeignnka
rraalnvigkmseaelieqlsrykpitkeeylrivegksgalfglalqlpallegelged
lynlgvtigtiyqmfddimdfagmekigkdgfldlkngvasfplvtamekfpearqmfen
rdwsglmsfmrekgilkeceetlkvlvknviienswlrdf

SCOPe Domain Coordinates for d1vg4b_:

Click to download the PDB-style file with coordinates for d1vg4b_.
(The format of our PDB-style files is described here.)

Timeline for d1vg4b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vg4a_