Lineage for d1vg4a_ (1vg4 A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777410Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 777411Superfamily a.128.1: Terpenoid synthases [48576] (5 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 777412Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (3 proteins)
  6. 777436Protein Octoprenyl-diphosphate synthase [101455] (1 species)
  7. 777437Species Thermotoga maritima [TaxId:2336] [101456] (10 PDB entries)
    Uniprot Q9X1M1
  8. 777449Domain d1vg4a_: 1vg4 A: [108602]

Details for d1vg4a_

PDB Entry: 1vg4 (more details), 3.3 Å

PDB Description: crystal structure of octaprenyl pyrophosphate synthase from hyperthermophilic thermotoga maritima f132a/l128a mutant
PDB Compounds: (A:) octoprenyl-diphosphate synthase

SCOP Domain Sequences for d1vg4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vg4a_ a.128.1.1 (A:) Octoprenyl-diphosphate synthase {Thermotoga maritima [TaxId: 2336]}
nsyelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveigedaissla
alelvhlasllhddvidgarfrrgketinfmygdkaavaagdlvlvsafhtveeignnka
rraalnvigkmseaelieqlsrykpitkeeylrivegksgalfglalqlpallegelged
lynlgvtigtiyqmfddimdfagmekigkdgfldlkngvasfplvtamekfpearqmfen
rdwsglmsfmrekgilkeceetlkvlvknviienswlrdf

SCOP Domain Coordinates for d1vg4a_:

Click to download the PDB-style file with coordinates for d1vg4a_.
(The format of our PDB-style files is described here.)

Timeline for d1vg4a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vg4b_