Lineage for d1vg2a_ (1vg2 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2731436Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2731437Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2731438Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)
  6. 2731488Protein Octoprenyl-diphosphate synthase [101455] (1 species)
  7. 2731489Species Thermotoga maritima [TaxId:2336] [101456] (10 PDB entries)
    Uniprot Q9X1M1
  8. 2731498Domain d1vg2a_: 1vg2 A: [108600]
    mutant

Details for d1vg2a_

PDB Entry: 1vg2 (more details), 3.1 Å

PDB Description: crystal structure of octaprenyl pyrophosphate synthase from hyperthermophilic thermotoga maritima a76y mutant
PDB Compounds: (A:) octoprenyl-diphosphate synthase

SCOPe Domain Sequences for d1vg2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vg2a_ a.128.1.1 (A:) Octoprenyl-diphosphate synthase {Thermotoga maritima [TaxId: 2336]}
qnsyelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveigedaissl
aalelvhlysllhddvidgarfrrgketinfmygdkaavaagdlvlvsafhtveeignnk
lrraflnvigkmseaelieqlsrykpitkeeylrivegksgalfglalqlpallegelge
dlynlgvtigtiyqmfddimdfagmekigkdgfldlkngvasfplvtamekfpearqmfe
nrdwsglmsfmrekgilkeceetlkvlvknviienswlrd

SCOPe Domain Coordinates for d1vg2a_:

Click to download the PDB-style file with coordinates for d1vg2a_.
(The format of our PDB-style files is described here.)

Timeline for d1vg2a_: