Lineage for d1vfza_ (1vfz A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2449392Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2449393Protein Kinesin [52646] (7 species)
  7. 2449434Species Mouse (Mus musculus), kif1a [TaxId:10090] [64017] (9 PDB entries)
    Uniprot P33173 3-355
  8. 2449438Domain d1vfza_: 1vfz A: [108595]
    complexed with adp, mg, vo4

Details for d1vfza_

PDB Entry: 1vfz (more details), 2.24 Å

PDB Description: crystal structure of the kif1a motor domain complexed with adp-mg-vo4
PDB Compounds: (A:) PROTEIN (Fusion protein consisting of Kinesin-like protein KIF1A, Kinesin heavy chain isoform 5C and A HIS TAG

SCOPe Domain Sequences for d1vfza_:

Sequence, based on SEQRES records: (download)

>d1vfza_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]}
asvkvavrvrpfnsremsrdskciiqmsgstttivnpkqpketpksfsfdysywshtspe
dinyasqkqvyrdigeemlqhafegynvcifaygqtgagksytmmgkqekdqqgiipqlc
edlfsrindttndnmsysvevsymeiycervrdllnpknkgnlrvrehpllgpyvedlsk
lavtsyndiqdlmdsgnkprtvaatnmnetssrshavfniiftqkrhdaetnittekvsk
islvdlagseradstgakgtrlkeganinkslttlgkvisalaemdsgpnknkkkkktdf
ipyrdsvltwllrenlggnsrtamvaalspadinydetlstlryadrakq

Sequence, based on observed residues (ATOM records): (download)

>d1vfza_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]}
asvkvavrvrpfnsremsrdskciiqmsgstttivnpkqpketpksfsfdysywshtspe
dinyasqkqvyrdigeemlqhafegynvcifaygqtgagksytmmgkqekdqqgiipqlc
edlfsrindttndnmsysvevsymeiycervrdllnpknkgnlrvrehpllgpyvedlsk
lavtsyndiqdlmdsgnkprtvaatnmnetssrshavfniiftqkrhdtnittekvskis
lvdlagseradstgakgtrlkeganinkslttlgkvisalaemdsgpfipyrdsvltwll
renlggnsrtamvaalspadinydetlstlryadrakq

SCOPe Domain Coordinates for d1vfza_:

Click to download the PDB-style file with coordinates for d1vfza_.
(The format of our PDB-style files is described here.)

Timeline for d1vfza_: