Lineage for d1vfwa_ (1vfw A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1364090Family c.37.1.9: Motor proteins [52641] (5 proteins)
  6. 1364091Protein Kinesin [52646] (7 species)
  7. 1364132Species Mouse (Mus musculus), kif1a [TaxId:10090] [64017] (9 PDB entries)
    Uniprot P33173 3-355
  8. 1364137Domain d1vfwa_: 1vfw A: [108593]
    complexed with anp, mg

Details for d1vfwa_

PDB Entry: 1vfw (more details), 2.3 Å

PDB Description: crystal structure of the kif1a motor domain complexed with mg-amppnp
PDB Compounds: (A:) PROTEIN (Fusion protein consisting of Kinesin-like protein KIF1A, Kinesin heavy chain isoform 5C and A HIS TAG

SCOPe Domain Sequences for d1vfwa_:

Sequence, based on SEQRES records: (download)

>d1vfwa_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]}
asvkvavrvrpfnsremsrdskciiqmsgstttivnpkqpketpksfsfdysywshtspe
dinyasqkqvyrdigeemlqhafegynvcifaygqtgagksytmmgkqekdqqgiipqlc
edlfsrindttndnmsysvevsymeiycervrdllnpknkgnlrvrehpllgpyvedlsk
lavtsyndiqdlmdsgnkprtvaatnmnetssrshavfniiftqkrhdaetnittekvsk
islvdlagseradstgakgtrlkeganinkslttlgkvisalaemdsgpnknkkkkktdf
ipyrdsvltwllrenlggnsrtamvaalspadinydetlstlryadrakqirntvsvnh

Sequence, based on observed residues (ATOM records): (download)

>d1vfwa_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]}
asvkvavrvrpfnsremsrdskciiqmsgstttivnpkqpketpksfsfdysywshtspe
dinyasqkqvyrdigeemlqhafegynvcifaygqtgagksytmmgkqekdqqgiipqlc
edlfsrindttndnmsysvevsymeiycervrdllnpknkgnlrvrehpllgpyvedlsk
lavtsyndiqdlmdsgnkprtvaattssrshavfniiftqkrhdaetnittekvskislv
dlagserganinkslttlgkvisalaemdfipyrdsvltwllrenlggnsrtamvaalsp
adinydetlstlryadrakqirntvsvnh

SCOPe Domain Coordinates for d1vfwa_:

Click to download the PDB-style file with coordinates for d1vfwa_.
(The format of our PDB-style files is described here.)

Timeline for d1vfwa_: