SCOP 1.69: Domain d1vftb1: 1vft B:1005-1012,B:1250-1384

Lineage for d1vftb1 (1vft B:1005-1012,B:1250-1384)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families)
   the barrel is decorated with additional structures

5. Family b.49.2.2: Alanine racemase [88682] (1 protein)

6. Protein Alanine racemase [50623] (3 species)

7. Species Streptomyces lavendulae [TaxId:1914] [110244] (3 PDB entries)

8. Domain d1vftb1: 1vft B:1005-1012,B:1250-1384 [108590]
   Other proteins in same PDB: d1vfta2, d1vftb2

Details for d1vftb1

PDB Entry: 1vft, 2.3 Å

PDB Description: Crystal structure of L-cycloserine-bound form of alanine racemase from D-cycloserine-producing Streptomyces lavendulae

SCOP Domain Sequences for d1vftb1:

Sequence; same for both SEQRES and ATOM records:

>d1vftb1 b.49.2.2 (B:1005-1012,B:1250-1384) Alanine racemase {Streptomyces lavendulae}
ptrvyaeiXmtlraslalvktvpaghgvsyghhyvtesethlalvpagyadgiprnasgr
gpvlvagkirraagriamdqfvvdlgedlaeagdeavilgdaergeptaedwaqaahtia
yeivtriggrvprvylgglehhhh

Timeline for d1vftb1:

• d1vftb1 is new in SCOP 1.69
  
• d1vftb1 appears in SCOP 1.71
  
• d1vftb1 appears in the current release, SCOPe 2.08