Lineage for d1vfsa1 (1vfs A:4-12,A:250-378)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067173Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 2067498Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 2067499Family b.49.2.2: Alanine racemase-like, C-terminal domain [88682] (2 proteins)
  6. 2067500Protein Alanine racemase [50623] (3 species)
  7. 2067520Species Streptomyces lavendulae [TaxId:1914] [110244] (3 PDB entries)
    Uniprot Q65YW7
  8. 2067521Domain d1vfsa1: 1vfs A:4-12,A:250-378 [108584]
    Other proteins in same PDB: d1vfsa2, d1vfsa3, d1vfsb2, d1vfsb3
    complexed with cl, dcs

Details for d1vfsa1

PDB Entry: 1vfs (more details), 1.9 Å

PDB Description: Crystal structure of D-cycloserine-bound form of alanine racemase from D-cycloserine-producing Streptomyces lavendulae
PDB Compounds: (A:) alanine racemase

SCOPe Domain Sequences for d1vfsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vfsa1 b.49.2.2 (A:4-12,A:250-378) Alanine racemase {Streptomyces lavendulae [TaxId: 1914]}
tptrvyaeiXmtlraslalvktvpaghgvsyghhyvtesethlalvpagyadgiprnasg
rgpvlvagkirraagriamdqfvvdlgedlaeagdeavilgdaergeptaedwaqaahti
ayeivtriggrvprvylgg

SCOPe Domain Coordinates for d1vfsa1:

Click to download the PDB-style file with coordinates for d1vfsa1.
(The format of our PDB-style files is described here.)

Timeline for d1vfsa1: