SCOPe 2.08: Domain d1vfsa1: 1vfs A:4-12,A:250-378

Lineage for d1vfsa1 (1vfs A:4-12,A:250-378)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
   barrel, closed; n=6, S=8; greek-key
   Many cradle-loop superfamilies may be homologous, according to PubMed 18457946

4. Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families)
   the barrel is decorated with additional structures

5. Family b.49.2.2: Alanine racemase-like, C-terminal domain [88682] (2 proteins)

6. Protein Alanine racemase [50623] (3 species)

7. Species Streptomyces lavendulae [TaxId:1914] [110244] (3 PDB entries)
   Uniprot Q65YW7

8. Domain d1vfsa1: 1vfs A:4-12,A:250-378 [108584]
   Other proteins in same PDB: d1vfsa2, d1vfsa3, d1vfsb2, d1vfsb3
   complexed with cl, dcs

Details for d1vfsa1

PDB Entry: 1vfs, 1.9 Å

PDB Description: Crystal structure of D-cycloserine-bound form of alanine racemase from D-cycloserine-producing Streptomyces lavendulae

PDB Compounds: (A:) alanine racemase

SCOPe Domain Sequences for d1vfsa1:

Sequence; same for both SEQRES and ATOM records:

>d1vfsa1 b.49.2.2 (A:4-12,A:250-378) Alanine racemase {Streptomyces lavendulae [TaxId: 1914]}
tptrvyaeiXmtlraslalvktvpaghgvsyghhyvtesethlalvpagyadgiprnasg
rgpvlvagkirraagriamdqfvvdlgedlaeagdeavilgdaergeptaedwaqaahti
ayeivtriggrvprvylgg

Timeline for d1vfsa1:

• d1vfsa1 first appeared in SCOP 1.69
  
• d1vfsa1 appears in SCOPe 2.07