Lineage for d1vfpa4 (1vfp A:1-124,A:240-343,A:751-994)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1458250Fold f.33: Calcium ATPase, transmembrane domain M [81666] (1 superfamily)
    core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains
  4. 1458251Superfamily f.33.1: Calcium ATPase, transmembrane domain M [81665] (1 family) (S)
  5. 1458252Family f.33.1.1: Calcium ATPase, transmembrane domain M [81664] (1 protein)
  6. 1458253Protein Calcium ATPase, transmembrane domain M [81663] (1 species)
    the N-terminal 40 residues interact with /form a part of transduction domain A
  7. 1458254Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (37 PDB entries)
    Uniprot P04191
  8. 1458293Domain d1vfpa4: 1vfp A:1-124,A:240-343,A:751-994 [108579]
    Other proteins in same PDB: d1vfpa1, d1vfpa2, d1vfpa3, d1vfpb1, d1vfpb2, d1vfpb3
    complexed with acp, ca, mg

Details for d1vfpa4

PDB Entry: 1vfp (more details), 2.9 Å

PDB Description: Crystal structure of the SR CA2+-ATPase with bound AMPPCP
PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d1vfpa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vfpa4 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl
lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk
eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy
yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf
irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp
prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh
phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls
mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg

SCOPe Domain Coordinates for d1vfpa4:

Click to download the PDB-style file with coordinates for d1vfpa4.
(The format of our PDB-style files is described here.)

Timeline for d1vfpa4: