Lineage for d1vfpa1 (1vfp A:125-239)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 567256Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 567928Superfamily b.82.7: Calcium ATPase, transduction domain A [81653] (1 family) (S)
    a distorted variant of double-helix
  5. 567929Family b.82.7.1: Calcium ATPase, transduction domain A [81652] (1 protein)
  6. 567930Protein Calcium ATPase, transduction domain A [81651] (1 species)
  7. 567931Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (9 PDB entries)
  8. 567939Domain d1vfpa1: 1vfp A:125-239 [108576]
    Other proteins in same PDB: d1vfpa2, d1vfpa3, d1vfpa4, d1vfpb2, d1vfpb3, d1vfpb4

Details for d1vfpa1

PDB Entry: 1vfp (more details), 2.9 Å

PDB Description: Crystal structure of the SR CA2+-ATPase with bound AMPPCP

SCOP Domain Sequences for d1vfpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vfpa1 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus)}
emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges
vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm

SCOP Domain Coordinates for d1vfpa1:

Click to download the PDB-style file with coordinates for d1vfpa1.
(The format of our PDB-style files is described here.)

Timeline for d1vfpa1: