Lineage for d1vfgb2 (1vfg B:1-136)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612756Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2612757Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2613089Family d.218.1.4: Poly A polymerase head domain-like [82661] (2 proteins)
    overlaps with the N-terminal part of Pfam PF01743; this family is distinct from eukaryotic PAPs
    insert X in the core is an alpha-beta(2) unit; contains two extra C-terminal strands; mixed 7-stranded sheet, order: 7612543
  6. 2613090Protein Poly A polymerase PcnB [110931] (1 species)
  7. 2613091Species Aquifex aeolicus [TaxId:63363] [110932] (1 PDB entry)
    Uniprot O66728 443-824
  8. 2613093Domain d1vfgb2: 1vfg B:1-136 [108573]
    Other proteins in same PDB: d1vfga1, d1vfgb1, d1vfgb3
    protein/RNA complex; complexed with apc

Details for d1vfgb2

PDB Entry: 1vfg (more details), 2.8 Å

PDB Description: Crystal structure of tRNA nucleotidyltransferase complexed with a primer tRNA and an incoming ATP analog
PDB Compounds: (B:) poly A polymerase

SCOPe Domain Sequences for d1vfgb2:

Sequence, based on SEQRES records: (download)

>d1vfgb2 d.218.1.4 (B:1-136) Poly A polymerase PcnB {Aquifex aeolicus [TaxId: 63363]}
mvgqiakemglrayivggvvrdillgkevwdvdfvvegnaielakelarrhgvnvhpfpe
fgtahlkigklklefatarretyprpgaypkvepaslkedlirrdftinamaisvnledy
gtlidyfgglrdlkdk

Sequence, based on observed residues (ATOM records): (download)

>d1vfgb2 d.218.1.4 (B:1-136) Poly A polymerase PcnB {Aquifex aeolicus [TaxId: 63363]}
mvgqiakemglrayivggvvrdillgkevwdvdfvvegnaielakelarrhgvnvhpfpe
fgtahlkigklklefatarretvepaslkedlirrdftinamaisvnledygtlidyfgg
lrdlkdk

SCOPe Domain Coordinates for d1vfgb2:

Click to download the PDB-style file with coordinates for d1vfgb2.
(The format of our PDB-style files is described here.)

Timeline for d1vfgb2: