![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
![]() | Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) ![]() |
![]() | Family d.218.1.4: Poly A polymerase head domain-like [82661] (2 proteins) overlaps with the N-terminal part of Pfam PF01743; this family is distinct from eukaryotic PAPs insert X in the core is an alpha-beta(2) unit; contains two extra C-terminal strands; mixed 7-stranded sheet, order: 7612543 |
![]() | Protein Poly A polymerase PcnB [110931] (1 species) |
![]() | Species Aquifex aeolicus [TaxId:63363] [110932] (1 PDB entry) Uniprot O66728 443-824 |
![]() | Domain d1vfgb2: 1vfg B:1-136 [108573] Other proteins in same PDB: d1vfga1, d1vfgb1, d1vfgb3 protein/RNA complex; complexed with apc |
PDB Entry: 1vfg (more details), 2.8 Å
SCOPe Domain Sequences for d1vfgb2:
Sequence, based on SEQRES records: (download)
>d1vfgb2 d.218.1.4 (B:1-136) Poly A polymerase PcnB {Aquifex aeolicus [TaxId: 63363]} mvgqiakemglrayivggvvrdillgkevwdvdfvvegnaielakelarrhgvnvhpfpe fgtahlkigklklefatarretyprpgaypkvepaslkedlirrdftinamaisvnledy gtlidyfgglrdlkdk
>d1vfgb2 d.218.1.4 (B:1-136) Poly A polymerase PcnB {Aquifex aeolicus [TaxId: 63363]} mvgqiakemglrayivggvvrdillgkevwdvdfvvegnaielakelarrhgvnvhpfpe fgtahlkigklklefatarretvepaslkedlirrdftinamaisvnledygtlidyfgg lrdlkdk
Timeline for d1vfgb2: