SCOPe 2.08: Domain d1vfgb2: 1vfg B:1-136

Lineage for d1vfgb2 (1vfg B:1-136)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families)

5. Family d.218.1.4: Poly A polymerase head domain-like [82661] (2 proteins)
   overlaps with the N-terminal part of Pfam PF01743; this family is distinct from eukaryotic PAPs
   insert X in the core is an alpha-beta(2) unit; contains two extra C-terminal strands; mixed 7-stranded sheet, order: 7612543

6. Protein Poly A polymerase PcnB [110931] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [110932] (1 PDB entry)
   Uniprot O66728 443-824

8. Domain d1vfgb2: 1vfg B:1-136 [108573]
   Other proteins in same PDB: d1vfga1, d1vfgb1, d1vfgb3
   protein/RNA complex; complexed with apc

Details for d1vfgb2

PDB Entry: 1vfg, 2.8 Å

PDB Description: Crystal structure of tRNA nucleotidyltransferase complexed with a primer tRNA and an incoming ATP analog

PDB Compounds: (B:) poly A polymerase

SCOPe Domain Sequences for d1vfgb2:

Sequence, based on SEQRES records:

>d1vfgb2 d.218.1.4 (B:1-136) Poly A polymerase PcnB {Aquifex aeolicus [TaxId: 63363]}
mvgqiakemglrayivggvvrdillgkevwdvdfvvegnaielakelarrhgvnvhpfpe
fgtahlkigklklefatarretyprpgaypkvepaslkedlirrdftinamaisvnledy
gtlidyfgglrdlkdk

Sequence, based on observed residues (ATOM records):

>d1vfgb2 d.218.1.4 (B:1-136) Poly A polymerase PcnB {Aquifex aeolicus [TaxId: 63363]}
mvgqiakemglrayivggvvrdillgkevwdvdfvvegnaielakelarrhgvnvhpfpe
fgtahlkigklklefatarretvepaslkedlirrdftinamaisvnledygtlidyfgg
lrdlkdk

Timeline for d1vfgb2:

• d1vfgb2 first appeared in SCOP 1.69
  
• d1vfgb2 appears in SCOPe 2.07