Lineage for d1vfgb1 (1vfg B:137-351)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348878Fold a.173: Poly A polymerase C-terminal region-like [81890] (1 superfamily)
    multihelical; can be divided into three subdomains (neck, body and tail)
  4. 2348879Superfamily a.173.1: Poly A polymerase C-terminal region-like [81891] (1 family) (S)
    the neck subdomain is an alpha-alpha superhelix; the tail subdomain is similar to the RuvA C-terminal domain-like
  5. 2348880Family a.173.1.1: Poly A polymerase C-terminal region-like [81892] (2 proteins)
    the 'neck' domain corresponds to the C-terminal part of Pfam PF01743
  6. 2348881Protein Poly A polymerase PcnB [109961] (1 species)
  7. 2348882Species Aquifex aeolicus [TaxId:63363] [109962] (1 PDB entry)
    Uniprot O66728 443-824
  8. 2348884Domain d1vfgb1: 1vfg B:137-351 [108572]
    Other proteins in same PDB: d1vfga2, d1vfgb2, d1vfgb3
    protein/RNA complex; complexed with apc

Details for d1vfgb1

PDB Entry: 1vfg (more details), 2.8 Å

PDB Description: Crystal structure of tRNA nucleotidyltransferase complexed with a primer tRNA and an incoming ATP analog
PDB Compounds: (B:) poly A polymerase

SCOPe Domain Sequences for d1vfgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vfgb1 a.173.1.1 (B:137-351) Poly A polymerase PcnB {Aquifex aeolicus [TaxId: 63363]}
virvlhpvsfiedpvrilralrfagrlnfklsrstekllkqavnlgllkeaprgrlinei
klalredrfleilelyrkyrvleeiiegfqwnekvlqklyalrkvvdwhalefseeridy
gwlyllilisnldyergkhfleemsapswvretykfmkfklgslkeelkkakenyevyrl
lkplhtsvllllmleeelkekiklyleklrkvklp

SCOPe Domain Coordinates for d1vfgb1:

Click to download the PDB-style file with coordinates for d1vfgb1.
(The format of our PDB-style files is described here.)

Timeline for d1vfgb1: