Lineage for d1vfga2 (1vfg A:1-136)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2239280Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2239281Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2239585Family d.218.1.4: Poly A polymerase head domain-like [82661] (2 proteins)
    overlaps with the N-terminal part of Pfam PF01743; this family is distinct from eukaryotic PAPs
    insert X in the core is an alpha-beta(2) unit; contains two extra C-terminal strands; mixed 7-stranded sheet, order: 7612543
  6. 2239586Protein Poly A polymerase PcnB [110931] (1 species)
  7. 2239587Species Aquifex aeolicus [TaxId:63363] [110932] (1 PDB entry)
    Uniprot O66728 443-824
  8. 2239588Domain d1vfga2: 1vfg A:1-136 [108571]
    Other proteins in same PDB: d1vfga1, d1vfgb1, d1vfgb3
    protein/RNA complex; complexed with apc

Details for d1vfga2

PDB Entry: 1vfg (more details), 2.8 Å

PDB Description: Crystal structure of tRNA nucleotidyltransferase complexed with a primer tRNA and an incoming ATP analog
PDB Compounds: (A:) poly A polymerase

SCOPe Domain Sequences for d1vfga2:

Sequence, based on SEQRES records: (download)

>d1vfga2 d.218.1.4 (A:1-136) Poly A polymerase PcnB {Aquifex aeolicus [TaxId: 63363]}
mvgqiakemglrayivggvvrdillgkevwdvdfvvegnaielakelarrhgvnvhpfpe
fgtahlkigklklefatarretyprpgaypkvepaslkedlirrdftinamaisvnledy
gtlidyfgglrdlkdk

Sequence, based on observed residues (ATOM records): (download)

>d1vfga2 d.218.1.4 (A:1-136) Poly A polymerase PcnB {Aquifex aeolicus [TaxId: 63363]}
mvgqiakemglrayivggvvrdillgkevwdvdfvvegnaielakelarrhgvnvhpfpe
fgtahlkigklklefatarretvepaslkedlirrdftinamaisvnledygtlidyfgg
lrdlkdk

SCOPe Domain Coordinates for d1vfga2:

Click to download the PDB-style file with coordinates for d1vfga2.
(The format of our PDB-style files is described here.)

Timeline for d1vfga2: