Lineage for d1vfga1 (1vfg A:137-351)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450184Fold a.173: Poly A polymerase C-terminal region-like [81890] (1 superfamily)
    multihelical; can be divided into three subdomains (neck, body and tail)
  4. 450185Superfamily a.173.1: Poly A polymerase C-terminal region-like [81891] (1 family) (S)
    the neck subdomain is an alpha-alpha superhelix; the tail subdomain is similar to the RuvA C-terminal domain-like
  5. 450186Family a.173.1.1: Poly A polymerase C-terminal region-like [81892] (2 proteins)
    the 'neck' domain corresponds to the C-terminal part of Pfam 01743
  6. 450187Protein Poly A polymerase PcnB [109961] (1 species)
  7. 450188Species Aquifex aeolicus [TaxId:63363] [109962] (1 PDB entry)
  8. 450189Domain d1vfga1: 1vfg A:137-351 [108570]
    Other proteins in same PDB: d1vfga2, d1vfgb2

Details for d1vfga1

PDB Entry: 1vfg (more details), 2.8 Å

PDB Description: Crystal structure of tRNA nucleotidyltransferase complexed with a primer tRNA and an incoming ATP analog

SCOP Domain Sequences for d1vfga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vfga1 a.173.1.1 (A:137-351) Poly A polymerase PcnB {Aquifex aeolicus}
virvlhpvsfiedpvrilralrfagrlnfklsrstekllkqavnlgllkeaprgrlinei
klalredrfleilelyrkyrvleeiiegfqwnekvlqklyalrkvvdwhalefseeridy
gwlyllilisnldyergkhfleemsapswvretykfmkfklgslkeelkkakenyevyrl
lkplhtsvllllmleeelkekiklyleklrkvklp

SCOP Domain Coordinates for d1vfga1:

Click to download the PDB-style file with coordinates for d1vfga1.
(The format of our PDB-style files is described here.)

Timeline for d1vfga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vfga2