Lineage for d1vf7g_ (1vf7 G:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633812Fold f.46: HlyD-like secretion proteins [111368] (1 superfamily)
    consists of three domains: beta-barrel (res. 29-38,170-259; (50412)); barrel-sandwich hybrid (39-72,135-169; (51230)) and long alpha-hairpin (73-134; (46556))
  4. 2633813Superfamily f.46.1: HlyD-like secretion proteins [111369] (2 families) (S)
  5. 2633814Family f.46.1.1: HlyD-like secretion proteins [111370] (1 protein)
    Pfam PF00529
  6. 2633815Protein Multidrug resistance protein MexA domain [111371] (1 species)
    periplasmic component of efflux pump; channel-forming oligomer, interacts with TolC
  7. 2633816Species Pseudomonas aeruginosa [TaxId:287] [111372] (2 PDB entries)
    Uniprot P52477
  8. 2633823Domain d1vf7g_: 1vf7 G: [108563]

Details for d1vf7g_

PDB Entry: 1vf7 (more details), 2.4 Å

PDB Description: Crystal structure of the membrane fusion protein, MexA of the multidrug transporter
PDB Compounds: (G:) Multidrug resistance protein mexA

SCOPe Domain Sequences for d1vf7g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vf7g_ f.46.1.1 (G:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]}
vtlntelpgrtnafriaevrpqvngiilkrlfkegsdvkagqqlyqidpatyeadyqsaq
anlastqeqaqrykllvadqavskqqyadanaaylqskaaveqarinlrytkvlspisgr
igrsavtegalvtngqanamatvqqldpiyvdvtqpstallrlrrelasgqleragdnaa
kvslkledgsqyplegrlefsevsvdegtgsvtiravfpnpnnellpgmfvhaqlqe

SCOPe Domain Coordinates for d1vf7g_:

Click to download the PDB-style file with coordinates for d1vf7g_.
(The format of our PDB-style files is described here.)

Timeline for d1vf7g_: