SCOP 1.71: Domain d1veub_: 1veu B:

Lineage for d1veub_ (1veu B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.110: Profilin-like [55769] (7 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family)
   alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices

5. Family d.110.7.1: Roadblock/LC7 domain [103197] (4 proteins)
   Pfam 03259

6. Protein Late endosomal/lysosomal Mp1 interacting protein p14 [111123] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [111124] (3 PDB entries)

8. Domain d1veub_: 1veu B: [108556]
   Other proteins in same PDB: d1veua_

Details for d1veub_

PDB Entry: 1veu, 2.15 Å

PDB Description: Crystal structure of the p14/MP1 complex at 2.15 A resolution

SCOP Domain Sequences for d1veub_:

Sequence; same for both SEQRES and ATOM records:

>d1veub_ d.110.7.1 (B:) Late endosomal/lysosomal Mp1 interacting protein p14 {Mouse (Mus musculus)}
gmlrpkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrn
gnqafnedslkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleepl
tqva

Timeline for d1veub_:

• d1veub_ first appeared in SCOP 1.69
  
• d1veub_ appears in SCOP 1.73
  
• d1veub_ appears in the current release, SCOPe 2.08, called d1veub1