Lineage for d1veub1 (1veu B:1-123)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2534513Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2535341Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 2535342Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
    Pfam PF03259
  6. 2535358Protein Late endosomal/lysosomal Mp1 interacting protein p14 [111123] (1 species)
  7. 2535359Species Mouse (Mus musculus) [TaxId:10090] [111124] (5 PDB entries)
    Uniprot Q9JHS3
  8. 2535364Domain d1veub1: 1veu B:1-123 [108556]
    Other proteins in same PDB: d1veua_, d1veub2

Details for d1veub1

PDB Entry: 1veu (more details), 2.15 Å

PDB Description: Crystal structure of the p14/MP1 complex at 2.15 A resolution
PDB Compounds: (B:) Late endosomal/lysosomal Mp1 interacting protein

SCOPe Domain Sequences for d1veub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1veub1 d.110.7.1 (B:1-123) Late endosomal/lysosomal Mp1 interacting protein p14 {Mouse (Mus musculus) [TaxId: 10090]}
mlrpkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrng
nqafnedslkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleeplt
qva

SCOPe Domain Coordinates for d1veub1:

Click to download the PDB-style file with coordinates for d1veub1.
(The format of our PDB-style files is described here.)

Timeline for d1veub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1veub2
View in 3D
Domains from other chains:
(mouse over for more information)
d1veua_