SCOPe 2.05: Domain d1vetb_: 1vet B:

Lineage for d1vetb_ (1vet B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family)
   alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices

5. Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
   Pfam PF03259

6. Protein Late endosomal/lysosomal Mp1 interacting protein p14 [111123] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [111124] (5 PDB entries)
   Uniprot Q9JHS3

8. Domain d1vetb_: 1vet B: [108554]
   Other proteins in same PDB: d1veta_

Details for d1vetb_

PDB Entry: 1vet, 1.9 Å

PDB Description: Crystal Structure of p14/MP1 at 1.9 A resolution

PDB Compounds: (B:) Late endosomal/lysosomal Mp1 interacting protein

SCOPe Domain Sequences for d1vetb_:

Sequence; same for both SEQRES and ATOM records:

>d1vetb_ d.110.7.1 (B:) Late endosomal/lysosomal Mp1 interacting protein p14 {Mouse (Mus musculus) [TaxId: 10090]}
mlrpkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrng
nqafnedslkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleep

Timeline for d1vetb_:

• d1vetb_ first appeared in SCOP 1.69
  
• d1vetb_ appears in SCOPe 2.04
  
• d1vetb_ appears in SCOPe 2.06
  
• d1vetb_ appears in the current release, SCOPe 2.08