SCOP 1.69: Domain d1veta_: 1vet A:

Lineage for d1veta_ (1vet A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.110: Profilin-like [55769] (7 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family)
   alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices

5. Family d.110.7.1: Roadblock/LC7 domain [103197] (3 proteins)
   Pfam 03259

6. Protein MEK binding partner 1, MP1 [111120] (2 species)
   remote homolog that forms the characteristic complex structures with other members

7. Species Mouse (Mus musculus) [TaxId:10090] [111122] (2 PDB entries)

8. Domain d1veta_: 1vet A: [108553]
   Other proteins in same PDB: d1vetb_

Details for d1veta_

PDB Entry: 1vet, 1.9 Å

PDB Description: Crystal Structure of p14/MP1 at 1.9 A resolution

SCOP Domain Sequences for d1veta_:

Sequence; same for both SEQRES and ATOM records:

>d1veta_ d.110.7.1 (A:) MEK binding partner 1, MP1 {Mouse (Mus musculus)}
addlkrflykklpsveglhaivvsdrdgvpvikvandsapehalrpgflstfalatdqgs
klglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelikvv
ev

Timeline for d1veta_:

• d1veta_ is new in SCOP 1.69
  
• d1veta_ appears in SCOP 1.71
  
• d1veta_ appears in the current release, SCOPe 2.08