Lineage for d1vera_ (1ver A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019405Protein Novel antigen receptor 12Y-1 [110044] (1 species)
  7. 2019406Species Spotted wobbegong (Orectolobus maculatus) [TaxId:168098] [110045] (1 PDB entry)
    Uniprot Q6X1E7 # fragment
  8. 2019407Domain d1vera_: 1ver A: [108550]

Details for d1vera_

PDB Entry: 1ver (more details), 2.82 Å

PDB Description: Structure of New Antigen Receptor variable domain from sharks
PDB Compounds: (A:) new antigen receptor variable domain

SCOPe Domain Sequences for d1vera_:

Sequence, based on SEQRES records: (download)

>d1vera_ b.1.1.1 (A:) Novel antigen receptor 12Y-1 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]}
awvdqtprtatketgesltincvlrdasyglestgwyrtklgstneqtisiggryvetvn
kgsksfslrirdlrvedsgtykcgafrfwlpygygslplsekgagtvltvk

Sequence, based on observed residues (ATOM records): (download)

>d1vera_ b.1.1.1 (A:) Novel antigen receptor 12Y-1 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]}
awvdqtprtatketgesltincvlrdasyglestgwyrtklgstneqtisiggryvetvn
kgsksfslrirdlrvedsgtykcgafrlsekgagtvltvk

SCOPe Domain Coordinates for d1vera_:

Click to download the PDB-style file with coordinates for d1vera_.
(The format of our PDB-style files is described here.)

Timeline for d1vera_: