Lineage for d1veqk_ (1veq K:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1988415Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. 1988893Protein Dodecameric ferritin homolog [47250] (14 species)
  7. 1989092Species Mycobacterium smegmatis [TaxId:1772] [109784] (5 PDB entries)
    Uniprot Q8VP75
  8. 1989123Domain d1veqk_: 1veq K: [108548]
    complexed with fe

Details for d1veqk_

PDB Entry: 1veq (more details), 3.98 Å

PDB Description: Mycobacterium smegmatis Dps Hexagonal form
PDB Compounds: (K:) starvation-induced DNA protecting protein

SCOPe Domain Sequences for d1veqk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1veqk_ a.25.1.1 (K:) Dodecameric ferritin homolog {Mycobacterium smegmatis [TaxId: 1772]}
sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr
gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk
siekledldlvsqdlliahagelekfqwfvrahlesag

SCOPe Domain Coordinates for d1veqk_:

Click to download the PDB-style file with coordinates for d1veqk_.
(The format of our PDB-style files is described here.)

Timeline for d1veqk_: