Lineage for d1veqi_ (1veq I:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 536008Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 536009Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 536010Family a.25.1.1: Ferritin [47241] (7 proteins)
  6. 536144Protein Dodecameric ferritin homolog [47250] (10 species)
  7. 536311Species Mycobacterium smegmatis [TaxId:1772] [109784] (3 PDB entries)
  8. 536327Domain d1veqi_: 1veq I: [108546]

Details for d1veqi_

PDB Entry: 1veq (more details), 3.98 Å

PDB Description: Mycobacterium smegmatis Dps Hexagonal form

SCOP Domain Sequences for d1veqi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1veqi_ a.25.1.1 (I:) Dodecameric ferritin homolog {Mycobacterium smegmatis}
sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr
gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk
siekledldlvsqdlliahagelekfqwfvrahlesag

SCOP Domain Coordinates for d1veqi_:

Click to download the PDB-style file with coordinates for d1veqi_.
(The format of our PDB-style files is described here.)

Timeline for d1veqi_: