Lineage for d1veqh_ (1veq H:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 910725Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 910726Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 910727Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 911056Protein Dodecameric ferritin homolog [47250] (14 species)
  7. 911249Species Mycobacterium smegmatis [TaxId:1772] [109784] (5 PDB entries)
    Uniprot Q8VP75
  8. 911277Domain d1veqh_: 1veq H: [108545]
    complexed with fe

Details for d1veqh_

PDB Entry: 1veq (more details), 3.98 Å

PDB Description: Mycobacterium smegmatis Dps Hexagonal form
PDB Compounds: (H:) starvation-induced DNA protecting protein

SCOPe Domain Sequences for d1veqh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1veqh_ a.25.1.1 (H:) Dodecameric ferritin homolog {Mycobacterium smegmatis [TaxId: 1772]}
sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr
gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk
siekledldlvsqdlliahagelekfqwfvrahlesag

SCOPe Domain Coordinates for d1veqh_:

Click to download the PDB-style file with coordinates for d1veqh_.
(The format of our PDB-style files is described here.)

Timeline for d1veqh_: