Lineage for d1veqf_ (1veq F:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. Protein Dodecameric ferritin homolog [47250] (16 species)
  7. Species Mycobacterium smegmatis [TaxId:1772] [109784] (5 PDB entries)
    Uniprot Q8VP75
  8. Domain d1veqf_: 1veq F: [108543]
    complexed with fe

Details for d1veqf_

PDB Entry: 1veq (more details), 3.98 Å

PDB Description: Mycobacterium smegmatis Dps Hexagonal form
PDB Compounds: (F:) starvation-induced DNA protecting protein

SCOPe Domain Sequences for d1veqf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1veqf_ a.25.1.1 (F:) Dodecameric ferritin homolog {Mycobacterium smegmatis [TaxId: 1772]}
sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr
gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk
siekledldlvsqdlliahagelekfqwfvrahlesag

SCOPe Domain Coordinates for d1veqf_ are not available.

Timeline for d1veqf_:

Domains from other chains:
(mouse over for more information)
d1veqa_, d1veqb_, d1veqc_, d1veqd_, d1veqe_, d1veqg_, d1veqh_, d1veqi_, d1veqj_, d1veqk_, d1veql_