Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein Dodecameric ferritin homolog [47250] (16 species) |
Species Mycobacterium smegmatis [TaxId:1772] [109784] (5 PDB entries) Uniprot Q8VP75 |
Domain d1veqd_: 1veq D: [108541] complexed with fe |
PDB Entry: 1veq (more details), 3.98 Å
SCOPe Domain Sequences for d1veqd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1veqd_ a.25.1.1 (D:) Dodecameric ferritin homolog {Mycobacterium smegmatis [TaxId: 1772]} sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk siekledldlvsqdlliahagelekfqwfvrahlesag
Timeline for d1veqd_: