![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.25: Ferritin-like [47239] (2 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (3 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (7 proteins) |
![]() | Protein Dodecameric ferritin homolog [47250] (10 species) |
![]() | Species Mycobacterium smegmatis [TaxId:1772] [109784] (3 PDB entries) |
![]() | Domain d1veqa_: 1veq A: [108538] |
PDB Entry: 1veq (more details), 3.98 Å
SCOP Domain Sequences for d1veqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1veqa_ a.25.1.1 (A:) Dodecameric ferritin homolog {Mycobacterium smegmatis} sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk siekledldlvsqdlliahagelekfqwfvrahlesag
Timeline for d1veqa_: