SCOPe 2.05: Domain d1velf_: 1vel F:

Lineage for d1velf_ (1vel F:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein Dodecameric ferritin homolog [47250] (14 species)

7. Species Mycobacterium smegmatis [TaxId:1772] [109784] (5 PDB entries)
   Uniprot Q8VP75

8. Domain d1velf_: 1vel F: [108537]
   complexed with cd, na, so4

Details for d1velf_

PDB Entry: 1vel, 2.99 Å

PDB Description: Mycobacterium smegmatis Dps tetragonal form

PDB Compounds: (F:) starvation-induced DNA protecting protein

SCOPe Domain Sequences for d1velf_:

Sequence; same for both SEQRES and ATOM records:

>d1velf_ a.25.1.1 (F:) Dodecameric ferritin homolog {Mycobacterium smegmatis [TaxId: 1772]}
sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr
gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk
siekledldlvsqdlliahagelekfqwfvrahlesaggqlth

Timeline for d1velf_:

• d1velf_ first appeared in SCOP 1.69
  
• d1velf_ appears in SCOPe 2.04
  
• d1velf_ appears in SCOPe 2.06
  
• d1velf_ appears in the current release, SCOPe 2.08