SCOPe 2.07: Domain d1vdla1: 1vdl A:8-74

Lineage for d1vdla1 (1vdl A:8-74)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (5 families)

5. Family a.5.2.1: UBA domain [46935] (25 proteins)

6. Protein Ubiquitin carboxyl-terminal hydrolase 25 [109721] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [109722] (1 PDB entry)
   Uniprot P57080 1-67

8. Domain d1vdla1: 1vdl A:8-74 [108528]
   Other proteins in same PDB: d1vdla2, d1vdla3
   Structural genomics target

Details for d1vdla1

PDB Entry: 1vdl

PDB Description: solution structure of rsgi ruh-013, a uba domain in mouse cdna

PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 25

SCOPe Domain Sequences for d1vdla1:

Sequence; same for both SEQRES and ATOM records:

>d1vdla1 a.5.2.1 (A:8-74) Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (Mus musculus) [TaxId: 10090]}
mtveqnvlqqsaaqkhqqtflnqlreitgindaqilqqalkdsngnlelavafltaknak
tppqeet

Timeline for d1vdla1:

• d1vdla1 first appeared in SCOP 1.69, called d1vdla_
  
• d1vdla1 appears in SCOPe 2.06
  
• d1vdla1 appears in the current release, SCOPe 2.08