Lineage for d1vdla_ (1vdl A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636335Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 636359Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 636360Family a.5.2.1: UBA domain [46935] (22 proteins)
  6. 636442Protein Ubiquitin carboxyl-terminal hydrolase 25 [109721] (1 species)
  7. 636443Species Mouse (Mus musculus) [TaxId:10090] [109722] (1 PDB entry)
  8. 636444Domain d1vdla_: 1vdl A: [108528]
    Structural genomics target

Details for d1vdla_

PDB Entry: 1vdl (more details)

PDB Description: solution structure of rsgi ruh-013, a uba domain in mouse cdna
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 25

SCOP Domain Sequences for d1vdla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vdla_ a.5.2.1 (A:) Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgmtveqnvlqqsaaqkhqqtflnqlreitgindaqilqqalkdsngnlelavaf
ltaknaktppqeetsgpssg

SCOP Domain Coordinates for d1vdla_:

Click to download the PDB-style file with coordinates for d1vdla_.
(The format of our PDB-style files is described here.)

Timeline for d1vdla_: