Lineage for d1vdla1 (1vdl A:8-74)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1984734Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1984758Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 1984759Family a.5.2.1: UBA domain [46935] (25 protein domains)
  6. 1984827Protein Ubiquitin carboxyl-terminal hydrolase 25 [109721] (1 species)
  7. 1984828Species Mouse (Mus musculus) [TaxId:10090] [109722] (1 PDB entry)
    Uniprot P57080 1-67
  8. 1984829Domain d1vdla1: 1vdl A:8-74 [108528]
    Other proteins in same PDB: d1vdla2, d1vdla3
    Structural genomics target

Details for d1vdla1

PDB Entry: 1vdl (more details)

PDB Description: Solution Structure of RSGI RUH-013, a UBA domain in Mouse cDNA
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 25

SCOPe Domain Sequences for d1vdla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vdla1 a.5.2.1 (A:8-74) Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (Mus musculus) [TaxId: 10090]}
mtveqnvlqqsaaqkhqqtflnqlreitgindaqilqqalkdsngnlelavafltaknak
tppqeet

SCOPe Domain Coordinates for d1vdla1:

Click to download the PDB-style file with coordinates for d1vdla1.
(The format of our PDB-style files is described here.)

Timeline for d1vdla1: