SCOP 1.71: Domain d1vdhe_: 1vdh E:

Lineage for d1vdhe_ (1vdh E:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (13 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.10: Chlorite dismutase-like [110965] (2 proteins)
   Pfam 06778; duplication: consists of two similar domains; forms a pentamer similar to the MLI decamer

6. Protein Polyketide synthase CurD homologue TTHA1714/TTC1352 [110968] (1 species)

7. Species Thermus thermophilus [TaxId:274] [110969] (1 PDB entry)

8. Domain d1vdhe_: 1vdh E: [108527]
   Structural genomics target
   mutant

Details for d1vdhe_

PDB Entry: 1vdh, 2 Å

PDB Description: Structure-based functional identification of a novel heme-binding protein from thermus thermophilus HB8

SCOP Domain Sequences for d1vdhe_:

Sequence; same for both SEQRES and ATOM records:

>d1vdhe_ d.58.4.10 (E:) Polyketide synthase CurD homologue TTHA1714/TTC1352 {Thermus thermophilus}
rhvpepthtlegwhvlhdfrlldfarwfsaplearedaweelkglvrewreleeagqgsy
giyqvvghkadllflnlrpgldplleaearlsrsafarylgrsysfysvvelgsqekpld
pespyvkprltprvpksgyvcfypmnkrrqgqdnwymlpakeraslmkahgetgrkyqge
vmqvisgaqglddwewgvdlfsedpvqfkkivyemrfdevsarygefgpffvgkyldeea
lraflgl

Timeline for d1vdhe_:

• d1vdhe_ first appeared in SCOP 1.69
  
• d1vdhe_ appears in SCOP 1.73
  
• d1vdhe_ appears in the current release, SCOPe 2.08