Lineage for d1vdhe_ (1vdh E:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. Family d.58.4.10: Chlorite dismutase-like [110965] (2 proteins)
    Pfam PF06778; duplication: consists of two similar domains; forms a pentamer similar to the MLI decamer
  6. Protein Polyketide synthase CurD homologue TTHA1714/TTC1352 [110968] (1 species)
  7. Species Thermus thermophilus [TaxId:274] [110969] (1 PDB entry)
    Uniprot Q5SHL6
  8. Domain d1vdhe_: 1vdh E: [108527]
    Structural genomics target

Details for d1vdhe_

PDB Entry: 1vdh (more details), 2 Å

PDB Description: Structure-based functional identification of a novel heme-binding protein from thermus thermophilus HB8
PDB Compounds: (E:) muconolactone isomerase-like protein

SCOPe Domain Sequences for d1vdhe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vdhe_ d.58.4.10 (E:) Polyketide synthase CurD homologue TTHA1714/TTC1352 {Thermus thermophilus [TaxId: 274]}
rhvpepthtlegwhvlhdfrlldfarwfsaplearedaweelkglvrewreleeagqgsy
giyqvvghkadllflnlrpgldplleaearlsrsafarylgrsysfysvvelgsqekpld
pespyvkprltprvpksgyvcfypmnkrrqgqdnwymlpakeraslmkahgetgrkyqge
vmqvisgaqglddwewgvdlfsedpvqfkkivyemrfdevsarygefgpffvgkyldeea
lraflgl

SCOPe Domain Coordinates for d1vdhe_ are not available.

Timeline for d1vdhe_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vdha_, d1vdhb_, d1vdhc_, d1vdhd_